PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C011683P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Trihelix
Protein Properties Length: 564aa    MW: 63552.8 Da    PI: 6.227
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C011683P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix87.51.6e-2758143186
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                     rW++qe+laL+++r++m++ +r++  k+plW+evs+k+ e gf+r+pk+Ckek+en+ k++k++k+ +++++++s++ +++ d+le
  MELO3C011683P1  58 RWPRQETLALLKIRSDMDTIFRDATHKAPLWDEVSRKLGELGFNRTPKKCKEKFENVYKYHKRTKDVRSGKSDNSKKVYRFSDELE 143
                     8*********************************************************************9999999999999987 PP

2trihelix103.12.1e-32393478187
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                     rW+k ev aLi++r+eme +++++  k+ lWee+s++mr  g++rs+k+Ckekwen+nk++kk+k ++kkr +e+s+tcpyf+ql+a
  MELO3C011683P1 393 RWPKGEVEALIRLRTEMEMKYQENGPKGLLWEEISSAMRGLGYNRSSKRCKEKWENINKYFKKVKYSNKKR-PEDSKTCPYFHQLDA 478
                     8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.36451115IPR017877Myb-like domain
SMARTSM007179.3E-555117IPR001005SANT/Myb domain
CDDcd122031.40E-2257122No hitNo description
PfamPF138373.9E-1757138No hitNo description
SMARTSM007171.1E-4390452IPR001005SANT/Myb domain
PROSITE profilePS500907.538392450IPR017877Myb-like domain
CDDcd122032.86E-26392457No hitNo description
Gene3DG3DSA:1.10.10.602.1E-4393449IPR009057Homeodomain-like
PfamPF138378.9E-23393479No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 564 aa     Download sequence    Send to blast
MDVVDPGEAA VTTEAVDAHE VGDSGGGGSG NGSNSGEEEK GSSLLLFEDG EKNFGGNRWP  60
RQETLALLKI RSDMDTIFRD ATHKAPLWDE VSRKLGELGF NRTPKKCKEK FENVYKYHKR  120
TKDVRSGKSD NSKKVYRFSD ELEAFDHPTS QHQNHMLFQS HHRHPSPPPP PPVLPTTTPP  180
PSFNPPAPKT INSTVPSTMN NITTNNKYSL PPKSSNNPLS NLPNMAANVI FSSSTSSSTA  240
SEEDPFRSSR RRRKKRKWSD FFLRLTKEVI EKQEGLQLKF LEALERIENQ RKLRDEAWRT  300
KEMTRVNQEH EVLVQEMSMA AAKDAAVVAF LQKIAPSSPP VPVPPPLPMT MTTQLQNGEN  360
NGKLSSTIGS HVISTTTTNG KVMSSIIVGS PSRWPKGEVE ALIRLRTEME MKYQENGPKG  420
LLWEEISSAM RGLGYNRSSK RCKEKWENIN KYFKKVKYSN KKRPEDSKTC PYFHQLDALY  480
REKEKSNMNF DINSQMEPLM VEPEQQWPPA FQPNNQVMGN NLQRINGEAN QEEEEDDHGD  540
DDDNDDDVEE EDIGGSSSTD VED*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1250255RRRKKR
2250256RRRKKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818170.0LN681817.1 Cucumis melo genomic scaffold, anchoredscaffold00015.
GenBankLN7132570.0LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008445762.10.0PREDICTED: trihelix transcription factor GT-2-like
SwissprotQ391171e-126TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLA0A0A0KE500.0A0A0A0KE50_CUCSA; Uncharacterized protein
STRINGSolyc12g056510.1.11e-137(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37334181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.12e-63Trihelix family protein